plasma peptide raises a handful of sensible questions. This page answers them in order, starting with the fundamentals and moving to applications.
Reviewed 2026-07-09. Anything still debated is marked as such rather than presented as settled.
Endogenous GHK occurs in blood plasma, saliva, and urine, and reported plasma concentrations decline with age in several studies. Researchers have proposed that the peptide acts as a copper carrier that delivers the metal to cells and to sites of injury. That transport role is a hypothesis supported by binding measurements and tissue-distribution data rather than a settled mechanism, and the peptide is generally described as a minor contributor to total plasma copper transport. Values reported in wound fluid and certain tissue extracts are higher than in circulating plasma.
The sequence carries three residues in the order glycine, histidine, lysine, which places a small, flexible chain around a single metal centre. Compared with larger copper-binding proteins, the complex is compact and its coordination chemistry can be reproduced with synthetic peptide in a laboratory. Published structural work agrees on the nitrogen donor set but differs in the exact geometry assigned under some conditions, so the arrangement is best treated as well characterised in outline rather than fixed in every detail.
The International Nomenclature of Cosmetic Ingredients lists the substance as copper tripeptide-1, the name that appears on most topical product labels. Related designations include copper peptide and GHK-Cu, and the hyphenated form is common in research literature. In cosmetics the material is regulated as an ingredient rather than as a drug, so products may reach the market without evidence of the effects claimed for them. Whether those effects are clinically meaningful is an open question, since most supportive data come from laboratory work and small trials.
GHK-Cu is the copper complex of the tripeptide glycyl-L-histidyl-L-lysine, a short sequence found naturally in human plasma, saliva and urine. Loren Pickart reported the isolation of the free peptide in 1973 while studying factors that influenced the growth of aged liver cells in culture. The peptide was later shown to bind copper(II) with high affinity, and the metal-bound form became the focus of most subsequent research. Its concentration in circulation declines markedly with age, a pattern that is well documented, though the physiological consequences of that decline remain debated.
| Property | Value | Notes |
|---|---|---|
| Chemical class | Copper(II)-tripeptide complex | One peptide ligand with one coordinated metal centre |
| Peptide sequence | Gly-His-Lys | Three residues written in one-letter notation |
| Free peptide mass | 340.4 g/mol | Metal-free GHK; the complex has a higher mass |
| Appearance | Blue to violet solid or solution | Colour originates from copper d orbital transitions |
| Storage | Desiccated, -20 °C, protected from light | Dry powder is more stable than dissolved material |
Material described in research and cosmetic supply chains is typically a synthetic peptide supplied as a lyophilized powder. Purity is commonly reported through chromatographic separation, often at 95 percent or higher, while copper content is confirmed by separate elemental analysis. Batch variation in color and solubility can reflect residual counter-ions, moisture, or partial oxidation of the peptide. Because the complex is not a single regulatory entity, specifications differ between suppliers and are not standardized internationally.
GHK-Cu is a coordination complex formed between the tripeptide glycyl-L-histidyl-L-lysine and a copper(II) ion. The peptide binds copper through its histidine imidazole nitrogen, its terminal amino group, and a deprotonated amide nitrogen, creating a stable chelate ring. The resulting complex carries a distinctive blue to blue-violet color, which arises from copper d-d electronic transitions. In the solid state it is usually handled as a powder, while in solution the complex can dissociate and re-form depending on pH and competing ligands. The name copper tripeptide-1 is widely used in ingredient listings.
Several names circulate for the same material, which complicates literature searches. Cosmetic ingredient lists often use copper tripeptide-1, while older biochemistry papers use glycyl-L-histidyl-lysine or its abbreviation GHK. The copper complex is sometimes written as GHK-Cu(II) to make the oxidation state explicit. Terminology is not fully standardized, so matching a compound across sources requires attention to the exact sequence, the counterion, and the stated copper content. Reviews that compare studies must account for these naming differences before drawing conclusions.
GHK-Cu is the copper(II) complex of the tripeptide glycyl-L-histidyl-L-lysine, a short sequence of three amino acids. The peptide was first isolated from human plasma in 1973 during research on factors that influence tissue repair in liver. Its ability to bind copper ions became a central point of interest because the metal changes the peptide's chemistry and its behaviour in laboratory systems. Today the compound appears in cosmetic formulations, cell-culture studies, and biochemistry literature under several names.
The peptide sequence places a histidine in the middle, and this residue dominates metal binding. Copper(II) coordinates through the imidazole nitrogen of histidine and the terminal amino group, forming a stable chelate ring system. Loss of the copper ion leaves the free tripeptide, which has different solubility and reactivity. This structural detail matters because assays that measure only the peptide backbone can miss whether copper is still bound to it.
Published work on GHK-Cu concentrates largely on cell culture systems rather than whole organisms. Frequently used endpoints include collagen synthesis, expression of matrix metalloproteinases, and migration of fibroblasts. Some reports describe antioxidant behavior, while others stress delivery of copper into cells. These mechanisms are proposed rather than demonstrated, and the relative weight of each pathway is unclear. Human trials are few and generally small, so laboratory findings should not be read as confirmed clinical results.
GHK-Cu is a coordination complex formed between the tripeptide glycyl-L-histidyl-L-lysine and a copper(II) ion. The peptide backbone consists of glycine, histidine, and lysine joined in that order. Copper is held through the imidazole nitrogen of histidine and the alpha-amino group at the N-terminus, which together produce a square-planar arrangement around the metal center. The solid appears blue to violet, a color that originates from d-d electronic transitions within the copper coordination sphere. The complex is indexed under CAS number 89030-95-5.
The sequence now called GHK was first reported in the early 1970s after isolation from human plasma, where it was noted to influence liver cell behavior in laboratory preparations. Later work described a copper-binding form and its activity in fibroblast and wound-model experiments. Review articles frequently group the substance with other copper peptides. Concentrations in blood appear to fall with age in several small surveys, although the reason for this trend is not settled. Whether such a decline carries functional consequences remains an open question.
A typical intracellular concentration of ATP is 1–10 μmol per gram of muscle tissue in a variety of eukaryotes. The dephosphorylation of ATP and rephosphorylation of ADP and AMP occur repeatedly in the course of aerobic metabolism. ATP can be produced by a number of distinct cellular processes; the three main pathways in eukaryotes are (1) glycolysis, (2) the citric acid cycle/oxidative phosphorylation, and (3) beta-oxidation. The overall process of oxidizing glucose to carbon dioxide, the combination of pathways 1 and 2, known as cellular respiration, produces about 30 equivalents of ATP from each molecule of glucose. ATP production by a non-photosynthetic aerobic eukaryote occurs mainly in the mitochondria, which comprise nearly 25% of the volume of a typical cell.
ProIAPP consists of 67 amino acids, which follow a 22 amino acid signal peptide which is rapidly cleaved after translation of the 89 amino acid coding sequence. The human sequence (from N-terminus to C-terminus) is: (MGILKLQVFLIVLSVALNHLKA) TPIESHQVEKR^ KCNTATCATQRLANFLVHSSNNFGAILSSTNVGSNTYG^ KR^ NAVEVLKREPLNYLPL. The signal peptide is removed during translation of the protein and transport into the endoplasmic reticulum. Once inside the endoplasmic reticulum, a disulfide bond is formed between cysteine residues numbers 2 and 7. Later in the secretory pathway, the precursor undergoes additional proteolysis and posttranslational modification (indicated by ^). 11 amino acids are removed from the N-terminus by the enzyme proprotein convertase 2 (PC2) while 16 are removed from the C-terminus of the proIAPP molecule by proprotein convertase 1/3 (PC1/3). At the C-terminus Carboxypeptidase E then removes the terminal lysine and arginine residues. The terminal glycine amino acid that results from this cleavage allows the enzyme peptidylglycine alpha-amidating monooxygenase (PAM) to convert the terminal glycine to an amine group (releasing glycolate). After this step, the transformation from the precursor protein proIAPP to the biologically active IAPP (amylin) is complete (IAPP sequence: KCNTATCATQRLANFLVHSSNNFGAILSSTNVGSNTY-NH2).
Immunofluorescence imaging in the human U2OS cell line (bone Osteosarcoma epithelial cells) shows localization in the cytosol. Immunohistochemistry imaging of human prostate tissue also suggests cytosolic localization. A bipartite nuclear localization signal is predicted at position 128 – 143, which is highly conserved in mammalian orthologs (see Fig.2.), indicating possible localization in the nucleus. The predicted promoter sequence for this gene spans from base pair 37196852 to 37198126 (1,275 bp) and has multiple predicted binding sites for transcription factors such as GATA binding factors, SMAD3, TP63 and NRF1. MIPOL1 is ubiquitously expressed at low levels in humans, with highest expression in the prostate. The RNA secondary structure is stabilized by multiple stem loops that have been predicted (using bioinformatics tools), and conserved across closely related species. Multiple binding targets are found for microRNAs such as MIR3163 and MIR190a, that could silence these regions on the mRNA and inhibit translation.
The American Society for Biochemistry and Molecular Biology publishes three research journals and a monthly magazine covering society news and activity updates. ASBMB journals are peer-reviewed and cover research in the fields of microbiology, molecular genetics, RNA-related research, proteomics, genomics, transcription, peptides, cell signaling, lipidomics, and systems biology. All articles are published online as "Papers in Press" upon acceptance. As of January 2021, all three ASBMB journals are fully open access.
Animals ingest amino acids in the form of protein. The protein is broken down into its constituent amino acids in the process of digestion. The amino acids are then used to synthesize new proteins and other nitrogenous biomolecules, or they are further catabolized through oxidation to provide a source of energy. The oxidation pathway starts with the removal of the amino group by a transaminase; the amino group is then fed into the urea cycle. The other product of transamidation is a keto acid that enters the citric acid cycle. Glucogenic amino acids can also be converted into glucose, through gluconeogenesis. Of the 20 standard amino acids, nine (His, Ile, Leu, Lys, Met, Phe, Thr, Trp and Val) are called essential amino acids because the human body cannot synthesize them from other compounds at the level needed for normal growth, so they must be obtained from food.
Sources: en.wikipedia.org
On-line mass spectrometry was develop to solve some of the limitations and problem that develop from off-line analysis, such as evaporation and chemical reactions of particles in the filters during long analysis time. On-line Mass spectrometry solves these problems through the collection and analysis of aerosol particles in real time. On-line instruments are very portable and allow for spatial variability to be examined. These portable instruments can be put on many different platforms such as boats, planes, and mobile platforms (e.g. car trailers). An example of this is in the picture at the beginning with the instrumentation attached to an aircraft. Like off-line, on-line mass spectrometry has many different type of instruments, which can be broken up into two types; instruments that measures the chemistry of the particle ensemble (bulk measurement) and those that measure the chemistry of individual particles (single-particle measurement). Thus based on analytical need different instrumentation is used in analysis of the aerosol particles.
Chromosome 11 open reading frame 91, or C11orf91 is a protein which in humans is encoded by the C11orf91 gene. The C11orf91 gene consists of 5159 nucleotides with an mRNA of approximately 836 base pairs. There is one exon found in the C11orf91 gene. The cytogenetic band location of C11orf91 is 11p13 and is located on the minus strand of the DNA . Annotated depiction of the C11orf91 mRNA and amino acid protein sequences. The C11orf91 gene encodes a protein that is 193 amino acids in length. The C11orf91 protein contains a domain of unknown function, DUF5529, that spans nearly the entire protein. RBMX protein binding sites were found to be highly conserved in several structures of human C11orf91 3'UTR and 5' UTR. C11orf91 is rich in serine and proline and poor in valine and asparagine. There is a proline rich region found in the middle of the C11orf91. The human C11orf91 protein is approximately 20 kDal and has an isoelectric point around 9. Human C11orf91 protein is predicted to be localized in vesicles. C11orf91 has two helices located near the C-terminus and no beta sheets.
Adrenocortical hormones are considered steroid hormones because of the shared characteristic of a cholesterol backbone. The structures of different steroids differ by the types and locations of additional atoms on a cholesterol backbone. The cholesterol backbone consists of four hydrocarbon rings, three cyclohexane rings and one cyclopentane, that contribute to its insolubility in aqueous environments. However, the hydrophobic nature allows them to readily diffuse through the plasma membrane of cells. This is important to the function of steroid hormones as they rely on cellular response pathways to restore the homeostatic imbalance that initiated the hormone release.
GLD-2 primarily stabilizes mRNAs that are translationally repressed as well as it strongly promotes bulk polyadenylation. Surprisingly, those functions seem to have little impact on dynamizing efficient target mRNA translation, as it is an efficient Poly(A) Polymerase which helps developing polyadenylation activity. This activity is stimulated by its interaction with a putative RNA-binding protein: GLD-3. It is proposed by some studies that GLD-3 stimulates GLD-2 by recruiting it to the RNA. If so, then bringing GLD-2 to the RNA by other means also should stimulate its activity. GLD-2, as a poly(A) polymerase (PAP) acts incorporating ATP at the 3' end of mRNAs in a template-independent manner. ==== Enzymatic activity: Polynucleotide adenylyltransferase activity ==== It has been discovered that this protein has a catalytic activity, in other words, it has the ability to increase the speed of chemical reactions which would not occur so fast. It is known to catalysis the following reaction (which requires the following cofactor: Mg(2+)): ATP + RNA(n) ⇄ diphosphate + RNA(n+1)
36. Georgian Med News. 2006 Apr;(133):111-5. Anti-aging peptide bioregulators induce reactivation of chromatin. Lezhava T(1), Monaselidze J, Kadotani T, Dvalishvili N, Buadze T. Author information: (1)Tbilisi State University. The effect of synthetic peptide bioregulators (Epitalon, Livagen and Vilon) on structural and facultative heterochromatin of cultivated lymphocytes have been studied among old (75-88yr.) people. The data obtained indicate that epitalon, livagen and vilon: 1) activate synthetic processes, caused by reactivation of ribosomal genes as a result of deheterochromatinization (decondensation) of nucleolus organizer regions; 2) induce unrolling (deheterochromatinization) of total heterochromatin; 3) release genes repressed by heterochromatinization (condensation) of euchromatic regions forming facultative heterochromatin; 4) epitalon and livagen induce deheterochromatinization (decondensation) of pericentromeric structural heterochromatin of the chromosomes1 and 9. However, vilon does not induce deheterochromatinization of pericentromeric structural heterochromatin. These results indicate that peptide bioregulators Epitalon, Livagen and Vilon cause activation (deheterochromatinization) of chromatin in lymphocytes of old individuals.
Sources: en.wikipedia.org
In Indonesia, the National Transportation Safety Committee (NTSC; Indonesian: Komite Nasional Keselamatan Transportasi, KNKT) is responsible for the investigation of incidents and accidents, including air accidents. Its aim is the improvement of transportation safety, not just aviation, in Indonesia. Created in 1999 in Italy, the Agenzia Nazionale per la Sicurezza del Volo (ANSV), has two main tasks: conducting technical investigations for civil aviation aircraft accidents and incidents, while issuing safety recommendations as appropriate; and conducting studies and surveys aimed at increasing flight safety. The organization is also responsible for establishing and maintaining the "voluntary reporting system". Although not under the supervision of the Ministry of Infrastructure and Transport, the ANSV is a public authority under the oversight of the Presidency of the Council of Ministers of Italy.
This inherited condition can be diagnosed with a blood test. If the total cholinesterase activity in the patient's blood is low, this may suggest an atypical form of the enzyme is present, putting the patient at risk of sensitivity to suxamethonium and related drugs. Inhibition studies may also be performed to give more information about potential risk. In some cases, genetic studies may be carried out to help identify the form of the enzyme that is present. Patients with known butyrylcholinesterase deficiency may wear a medic-alert bracelet that will notify healthcare workers of increased risk from administration of succinylcholine, and use a non-depolarising neuromuscular-blocking drug for general anesthesia, such as rocuronium. Prognosis for recovery following administration of succinylcholine is excellent when medical support includes close monitoring and respiratory support measures. In nonmedical settings in which subjects with butyrylcholinesterase deficiency are exposed to cocaine, sudden cardiac death can occur.
RANKL is a member of the TNF superfamily of ligands. Through binding to the RANK receptor it activates various molecules, like NF-kappa B, MAPK, NFAT and PI3K52. The RANKL/RANK signaling pathway regulates osteoclastogenesis, as well as, the survival and activation of osteoclasts. Adenosine is very relevant in bone metabolism, as it plays a role in formation and activation of both osteoclasts and osteoblasts. Adenosine acts by binding to purinergic receptors and influencing adenylyl cyclase activity and the formation of cAMP and PKA 54. Adenosine may have opposite effects on bone metabolism, because while certain purinergic receptors stimulate adenylyl cyclase activity, others have the opposite effect. Under certain circumstances adenosine stimulates bone destruction and in other situations it promotes bone formation, depending on the purinergic receptor that is being activated.
H3A (aq) + H2O (l) ⇌ H3O+ (aq) + H2A− (aq) Ka1 H2A− (aq) + H2O (l) ⇌ H3O+ (aq) + HA2− (aq) Ka2 HA2− (aq) + H2O (l) ⇌ H3O+ (aq) + A3− (aq) Ka3 An inorganic example of a triprotic acid is orthophosphoric acid (H3PO4), usually just called phosphoric acid. All three protons can be successively lost to yield H2PO−4, then HPO2−4, and finally PO3−4, the orthophosphate ion, usually just called phosphate. Even though the positions of the three protons on the original phosphoric acid molecule are equivalent, the successive Ka values differ since it is energetically less favorable to lose a proton if the conjugate base is more negatively charged. An organic example of a triprotic acid is citric acid, which can successively lose three protons to finally form the citrate ion. Although the subsequent loss of each hydrogen ion is less favorable, all of the conjugate bases are present in solution. The fractional concentration, α (alpha), for each species can be calculated. For example, a generic diprotic acid will generate 3 species in solution: H2A, HA−, and A2−. The fractional concentrations can be calculated as below when given either the pH (which can be converted to the [H+]) or the concentrations of the acid with all its conjugate bases:
Since TPD observes the mass of desorbed molecules, it shows what molecules are adsorbed on the surface. Moreover, TPD recognizes the different adsorption conditions of the same molecule from the differences between the desorption temperatures of molecules desorbing different sites at the surface, e.g. terraces vs. steps. TPD also obtains the amounts of adsorbed molecules on the surface from the intensity of the peaks of the TPD spectrum, and the total amount of adsorbed species is shown by the integral of the spectrum. To measure TPD, one needs a mass spectrometer, such as a quadrupole mass spectrometer or a time-of-flight (TOF) mass spectrometer, under ultrahigh vacuum (UHV) conditions. The amount of adsorbed molecules is measured by increasing the temperature at a heating rate of typically 2 K/s to 10 K/s. Several masses may be simultaneously measured by the mass spectrometer, and the intensity of each mass as a function of temperature is obtained as a TDS spectrum. The heating procedure is often controlled by the PID control algorithm, with the controller being either a computer or specialised equipment such as a Eurotherm. Other methods of measuring desorption are Thermal Gravimetric Analysis (TGA) or using infrared detectors, thermal conductivity detectors etc.
Sources: en.wikipedia.org
It consists of a three-amino-acid peptide, glycine-histidine-lysine, bound to one copper(II) ion. The peptide supplies four nitrogen donor atoms, and the resulting complex is stable in neutral aqueous solution. The metal-free peptide is usually called GHK.
The three letters are the standard one-letter codes for glycine, histidine, and lysine. The suffix -Cu indicates the coordinated copper ion. Cosmetic ingredient lists often use the alternative name copper tripeptide-1 for the same complex.
No. Free GHK is the peptide alone, while GHK-Cu contains a bound copper atom. The two differ in colour, charge, and binding behaviour, so any study that measures copper delivery must state which form was used.
It is a complex of a three-amino-acid peptide, glycine, histidine and lysine, bound to a single copper(II) ion. The metal is held mainly by the histidine side chain and the peptide backbone. Most commercial material is supplied as an acetate salt rather than as the free complex.